PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400038614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 418aa    MW: 46020.1 Da    PI: 7.4097
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400038614genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.81.7e-3163120260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  PGSC0003DMP400038614  63 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 120
                           8****************************************.***************85 PP

2WRKY107.28.3e-34238296159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+v+g+++prsYY+CtsagCpv+k+ver+++dpk+v++tYeg+Hnh+
  PGSC0003DMP400038614 238 LDDGYKWRKYGQKVVRGNPNPRSYYKCTSAGCPVRKHVERASHDPKAVITTYEGKHNHD 296
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-2653121IPR003657WRKY domain
PROSITE profilePS5081122.13657121IPR003657WRKY domain
SuperFamilySSF1182901.57E-2459121IPR003657WRKY domain
SMARTSM007743.4E-3362120IPR003657WRKY domain
PfamPF031065.6E-2463119IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.3E-38223298IPR003657WRKY domain
SuperFamilySSF1182901.31E-29230298IPR003657WRKY domain
PROSITE profilePS5081138.939233298IPR003657WRKY domain
SMARTSM007747.3E-39238297IPR003657WRKY domain
PfamPF031063.2E-26239296IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
METSKELSLS APINVDASSK EESLYEPINV DAMNPRDQSS ASMQGSHADH KDVSSVTSDR  60
SSDDGYNWRK YGQKLVKGSE FPRSYYKCTY PNCEVKKIFE RSPEGQITEI VYKGSHDHPK  120
PQLSRRFSPG ALMSIQEDKC EKEACFRGQE VYVEDKLNNN VQTSKTEPSS TPVSPQQADT  180
GGLEGAGSQM HGTNDDMDED DQFAKRRKMD GGMDITPVIK PIREPRVVVQ TVSEVDILDD  240
GYKWRKYGQK VVRGNPNPRS YYKCTSAGCP VRKHVERASH DPKAVITTYE GKHNHDVPAA  300
KNNNHEMTGS SPVTGSSRIR AGETNSLSLD LGVGTGYRLD NGNNGQLHTL HHQVQVSRSG  360
MMLVQPAAVA ARYGIVHSGM SRFGAIDNRV QGPSFETLPL QPSTQSLQNY GKILLGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-3863299878Probable WRKY transcription factor 4
2lex_A6e-3863299878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111290.0AB711129.1 Solanum tuberosum StWRKY17 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015163659.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV01e-118WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM1C0Z40.0M1C0Z4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000574090.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-118WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]